PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00295g01125.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 299aa    MW: 33988.2 Da    PI: 6.1264
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00295g01125.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.6e-171459148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                              +g+WT+eEd++l ++++++G g+W++ ++  g  Rt++++k++w+++l
  Peaxi162Scf00295g01125.1 14 KGPWTPEEDQKLTNYINKHGHGSWRALPKLAG--RTDNEIKNFWNTHL 59
                              79*****************************8..***********996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.4E-22566IPR009057Homeodomain-like
PROSITE profilePS5129421.332963IPR017930Myb domain
SuperFamilySSF466895.6E-161068IPR009057Homeodomain-like
SMARTSM007175.8E-151361IPR001005SANT/Myb domain
PfamPF002494.1E-151459IPR001005SANT/Myb domain
CDDcd001677.12E-131659No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MGRSPCCDES GLKKGPWTPE EDQKLTNYIN KHGHGSWRAL PKLAGRTDNE IKNFWNTHLK  60
KKLIQMGYDP MTHRPRTDIF DSLQQLIALA KLKELMEHHS WEEQAMRLQS EVAKLNYLQN  120
FLQPHNTSFN AIQDIEAYNL LNSLSSFKDS LVLGTNNHLQ IPTISTSSSL QAIQDSIPFS  180
HLPELQTPRS NFKTSLNKDS VRPQNTEFNV MSHGETSPTS PWLTSSLSPS PPPPVINDET  240
KNENSLEVMI SSCLPEERKL SDHLFQPNNE RSLSNEGAPP SVWPDLLLED SFFQDIVKF
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754443e-58HG975444.1 Solanum pennellii chromosome ch05, complete genome.
GenBankHG9755173e-58HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016494001.11e-143PREDICTED: myb-related protein 330-like
TrEMBLK4C1I61e-118K4C1I6_SOLLC; Uncharacterized protein
STRINGSolyc05g051550.1.11e-117(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10280.11e-57myb domain protein 92